PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG576500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 162aa    MW: 17649.8 Da    PI: 6.3551
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG576500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.71.7e-5814110197
                NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                          vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+yveplk+yl+ky
  Pavir.5NG576500.1.p  14 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYVEPLKMYLHKY 103
                          69**************************************************************************************** PP

                NF-YB  91 relegek 97 
                          re+eg++
  Pavir.5NG576500.1.p 104 REMEGDS 110
                          *****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-5412119IPR009072Histone-fold
SuperFamilySSF471131.71E-4017113IPR009072Histone-fold
PfamPF008081.2E-282084IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-224866No hitNo description
PROSITE patternPS0068505167IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-226785No hitNo description
PRINTSPR006151.4E-2286104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MADDGGSHEG GGGVREQDRF LPIANISRIM KKAVPANGKI AKDAKETLQE CVSEFISFVT  60
SEASDKCQKE KRKTINGDDL LWAMATLGFE EYVEPLKMYL HKYREMEGDS KLSTKAGEGS  120
VKKDAISPHG GTSSSSNQLV QHGVYNQGMG YMQPQYHNGD T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B9e-4913105294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A9e-4913105294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.114911e-158callus| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9757580.0EU975758.1 Zea mays clone 499728 nuclear transcription factor Y subunit B-3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001278514.11e-106nuclear transcription factor Y subunit B-3
RefseqXP_004970483.11e-106PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotP252091e-90NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLB6UBN31e-106B6UBN3_MAIZE; CCAAT-HAP3 transcription factor
TrEMBLK3XMN61e-106K3XMN6_SETIT; Uncharacterized protein
STRINGSi003159m1e-105(Setaria italica)
STRINGGRMZM2G303465_P041e-105(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.12e-70nuclear factor Y, subunit B10